Skip to content
verdictbakery verdictbakery

Get The best recipes

  • Home
  • All Recipes
    • Appetizers & Snacks
    • Baking & Desserts
    • Vegetarian & Vegan
  • Main Dishes
    • 🥩 Beef & Steak
    • 🍗 Chicken & Poultry
    • 🐟 Salmon & Fish
    • 🥦 Vegetarian & Vegan Meals
  • Baking & Desserts.
  • Breakfast and Smoothies
  • Appetizers and Snacks
  • Favorites
  • Contact Us
verdictbakery
verdictbakery

Get The best recipes

Easy vegan matcha pancakes – recipes from the vegetarian world

Le, avril 29, 2025


Jump

Saint-Patty is almost there! I am not Irish, but I really like a good celebration of Saint-Patrick and of course, one of my favorite things on the holidays is to make green food. These matcha pancakes are my favorite matcha recipe and I have the complete recipe below.

What you will need

  • 1 cup of flour⁣
  • 1 tablespoon of chemical yeast⁣
  • 1 tablespoon of sugar⁣
  • 1 tablespoon of matcha powder
  • 1 cup of milk without dairy products⁣
  • 1 tablespoon of coconut oil
  • 1 teaspoon of vanilla

How to make these pancakes

  • Combine all the ingredients in a large bowl and mix them well.
  • Grease your pan and add about ¼ cup of dough to the pan for each pancake.
  • Cook for a few minutes on each side, then return and do the same on the other.
  • When all your pancakes have cooked, stack them and garnish with cocoot or yogurt and maple syrup and berries.
  • I also added pumpkin and chia seeds to mine!

You will find below a video that can help you see exactly how I made this recipe.

https://www.youtube.com/watch?

If you liked these matcha pancakes, you might also like these other vegan pancake recipes:

Crêpes with chocolate chips

Chocolate protein pancakes

apple pancakes

green pancakes on a plate

Easy vegan matcha matcha pancake recipe

Gaby Dimova

Delicious and easy to make vegan pancakes.

Preparation time 10 minutes min

Cook time 10 minutes min

Total time 20 minutes min

Course Breakfast

Kitchen Japanese

Portions 2 people

Calories 372 kcal

Equipment

  • stove

  • large bowl

  • Mix the spoon

Ingredients

  • 1 cup flour⁣
  • 1 tablespoon pulp
  • 1 tablespoon Sugar⁣
  • 1 tablespoon matcha powder
  • 1 cup milk without dairy products⁣
  • 1 tablespoon coconut oil
  • 1 teaspoon vanilla

Instructions

  • Combine all the ingredients in a large bowl and mix them well.

  • Grease your pan and add about ¼ cup of dough to the pan for each pancake.

  • Cook for a few minutes on each side, then return and do the same on the other.

  • When all your pancakes have cooked, stack them and garnish with cocoot or yogurt and maple syrup and berries.

  • I also added pumpkin and chia seeds to mine.

Video

https://www.youtube.com/watch?

Nutrition

Calories: 372kcalCarbohydrates: 55gProtein: 15gFat: 11gSaturated fats: 7gPolyunsaturated fat: 2gMonounsaturated fat: 1gSodium: 696MGPotassium: 388MGFiber: 7gSugar: 9gVitamin A: 844IUVitamin C: 8MGCalcium: 538MGIron: 5MG

BreakFast easymatchapancakesrecipesveganvegetarianworld

Navigation de l’article

Previous post
Next post

Related Posts

BreakFast

Gluten Free Overnight Oats – Veggie World Recipes

avril 27, 2025

Jump These apples gluten -free night oats are so easy to prepare, with incredible taste and are perfect for fall breakfast or dessert! Even better, they are an easy breakfast to make vegan makeup, gluten-free and which has a delicious pudding texture! Take advantage of apple nights at any time…

Read More
BreakFast

Iced yogurt bark with fruits and granola

avril 26, 2025

Jump As the temperature increases and the hot summer days approach, we all want a fresh and delicious treat to satisfy our sweet tooth. Instead of reaching ice cream, why not try a healthier alternative like this Icy yogurt bark. He incorporates the goodness of yogurt and a range of…

Read More

Easy green smoothie bowl – recipes from the vegetarian world

avril 28, 2025

Posted: January 3, 2021 Modified: November 10, 2022 by Gaby Dimova This message may contain affiliation links 1 comment Jump This recipe is very simple, but it’s one of my favorite Go-Tos when I want a snack or an easy and refreshing breakfast that is nutritious, that’s why I wanted…

Read More

Recent Posts

  • Vegan Zucchini Bread – Veggie World Recipes
  • Oven cake in oven oven – recipes from the vegetarian world
  • Chocolate oats – recipes from the vegetarian world
  • Chocolate protein Chia Pudding – Recipes from the vegetarian world
  • Coconut Chia Pudding – Veggie World Recipes

Recent Comments

Aucun commentaire à afficher.

Archives

  • octobre 2025
  • avril 2025
  • mars 2025
  • février 2025
  • janvier 2025
  • décembre 2024
  • novembre 2024
  • octobre 2024

Categories

  • All Recipes
  • Appetizers & Snacks
  • Baking & Desserts
  • BreakFast
  • Breakfast & Smoothies
  • Dressings & Sauces
  • Favorites
  • Main Dishes
  • Recipes By Features
  • Vegetarian & Vegan
  • Privacy Policy
  • Terms of Use
  • About verdictbakery
©2026 verdictbakery | WordPress Theme by SuperbThemes