Skip to content
verdictbakery verdictbakery

Get The best recipes

  • Home
  • All Recipes
    • Appetizers & Snacks
    • Baking & Desserts
    • Vegetarian & Vegan
  • Main Dishes
    • 🥩 Beef & Steak
    • 🍗 Chicken & Poultry
    • 🐟 Salmon & Fish
    • 🥦 Vegetarian & Vegan Meals
  • Baking & Desserts.
  • Breakfast and Smoothies
  • Appetizers and Snacks
  • Favorites
  • Contact Us
verdictbakery
verdictbakery

Get The best recipes

Easy vegan matcha pancakes – recipes from the vegetarian world

Le, avril 29, 2025


Jump

Saint-Patty is almost there! I am not Irish, but I really like a good celebration of Saint-Patrick and of course, one of my favorite things on the holidays is to make green food. These matcha pancakes are my favorite matcha recipe and I have the complete recipe below.

What you will need

  • 1 cup of flour⁣
  • 1 tablespoon of chemical yeast⁣
  • 1 tablespoon of sugar⁣
  • 1 tablespoon of matcha powder
  • 1 cup of milk without dairy products⁣
  • 1 tablespoon of coconut oil
  • 1 teaspoon of vanilla

How to make these pancakes

  • Combine all the ingredients in a large bowl and mix them well.
  • Grease your pan and add about ¼ cup of dough to the pan for each pancake.
  • Cook for a few minutes on each side, then return and do the same on the other.
  • When all your pancakes have cooked, stack them and garnish with cocoot or yogurt and maple syrup and berries.
  • I also added pumpkin and chia seeds to mine!

You will find below a video that can help you see exactly how I made this recipe.

https://www.youtube.com/watch?

If you liked these matcha pancakes, you might also like these other vegan pancake recipes:

Crêpes with chocolate chips

Chocolate protein pancakes

apple pancakes

green pancakes on a plate

Easy vegan matcha matcha pancake recipe

Gaby Dimova

Delicious and easy to make vegan pancakes.

Preparation time 10 minutes min

Cook time 10 minutes min

Total time 20 minutes min

Course Breakfast

Kitchen Japanese

Portions 2 people

Calories 372 kcal

Equipment

  • stove

  • large bowl

  • Mix the spoon

Ingredients

  • 1 cup flour⁣
  • 1 tablespoon pulp
  • 1 tablespoon Sugar⁣
  • 1 tablespoon matcha powder
  • 1 cup milk without dairy products⁣
  • 1 tablespoon coconut oil
  • 1 teaspoon vanilla

Instructions

  • Combine all the ingredients in a large bowl and mix them well.

  • Grease your pan and add about ¼ cup of dough to the pan for each pancake.

  • Cook for a few minutes on each side, then return and do the same on the other.

  • When all your pancakes have cooked, stack them and garnish with cocoot or yogurt and maple syrup and berries.

  • I also added pumpkin and chia seeds to mine.

Video

https://www.youtube.com/watch?

Nutrition

Calories: 372kcalCarbohydrates: 55gProtein: 15gFat: 11gSaturated fats: 7gPolyunsaturated fat: 2gMonounsaturated fat: 1gSodium: 696MGPotassium: 388MGFiber: 7gSugar: 9gVitamin A: 844IUVitamin C: 8MGCalcium: 538MGIron: 5MG

BreakFast easymatchapancakesrecipesveganvegetarianworld

Navigation de l’article

Previous post
Next post

Related Posts

BreakFast

White chocolate raspberry scones – recipes from the vegetarian world

avril 27, 2025

Sweet and soft, these White chocolate raspberry scones Drame with tangy raspberries and soft white vegan chocolate, making these scones an ideal breakfast on the go, afternoon treat or at any time. Fidden raspberries, white chocolate chips, vegan butter and creamy coconut milk come together for an incredibly soft vegan…

Read More
BreakFast

Tasty vegan muffins – recipes from the vegetarian world

avril 29, 2025

Jump Recently, my mother told me about a new recipe that she tried on Pinterest for muffins that were not made with only an egg and vegetables. I have already seen this idea and absolute love how simple it is, so I wanted to make my own version, but vegan….

Read More
BreakFast

Cinnamon roll pancakes – veggie world recipes

avril 27, 2025

Posted: June 8, 2020 Modified: May 31, 2024 by Gaby Dimova This message may contain affiliation links 1 comment Jump Delivered the ultimate combination of two of the best breakfast foods; Rolls and cinnamon pancakes with that Cinnamon pankes recipe. The pancakes have never had such a good taste! Crêpes…

Read More

Recent Posts

  • Acai smoothie – Recipes from the vegetarian world
  • Frozen Yogurt Cups – Veggie World Recipes
  • Vegan Zucchini Bread – Veggie World Recipes
  • Oven cake in oven oven – recipes from the vegetarian world
  • Chocolate oats – recipes from the vegetarian world

Recent Comments

Aucun commentaire à afficher.

Archives

  • mars 2026
  • octobre 2025
  • avril 2025
  • mars 2025
  • février 2025
  • janvier 2025
  • décembre 2024
  • novembre 2024
  • octobre 2024

Categories

  • All Recipes
  • Appetizers & Snacks
  • Baking & Desserts
  • BreakFast
  • Breakfast & Smoothies
  • Dressings & Sauces
  • Favorites
  • Main Dishes
  • Recipes By Features
  • Vegetarian & Vegan
  • Privacy Policy
  • Terms of Use
  • About verdictbakery
©2026 verdictbakery | WordPress Theme by SuperbThemes