Skip to content
verdictbakery verdictbakery

Get The best recipes

  • Home
  • All Recipes
    • Appetizers & Snacks
    • Baking & Desserts
    • Vegetarian & Vegan
  • Main Dishes
    • 🥩 Beef & Steak
    • 🍗 Chicken & Poultry
    • 🐟 Salmon & Fish
    • 🥦 Vegetarian & Vegan Meals
  • Baking & Desserts.
  • Breakfast and Smoothies
  • Appetizers and Snacks
  • Favorites
  • Contact Us
verdictbakery
verdictbakery

Get The best recipes

Easy vegan matcha pancakes – recipes from the vegetarian world

Le, avril 29, 2025


Jump

Saint-Patty is almost there! I am not Irish, but I really like a good celebration of Saint-Patrick and of course, one of my favorite things on the holidays is to make green food. These matcha pancakes are my favorite matcha recipe and I have the complete recipe below.

What you will need

  • 1 cup of flour⁣
  • 1 tablespoon of chemical yeast⁣
  • 1 tablespoon of sugar⁣
  • 1 tablespoon of matcha powder
  • 1 cup of milk without dairy products⁣
  • 1 tablespoon of coconut oil
  • 1 teaspoon of vanilla

How to make these pancakes

  • Combine all the ingredients in a large bowl and mix them well.
  • Grease your pan and add about ¼ cup of dough to the pan for each pancake.
  • Cook for a few minutes on each side, then return and do the same on the other.
  • When all your pancakes have cooked, stack them and garnish with cocoot or yogurt and maple syrup and berries.
  • I also added pumpkin and chia seeds to mine!

You will find below a video that can help you see exactly how I made this recipe.

https://www.youtube.com/watch?

If you liked these matcha pancakes, you might also like these other vegan pancake recipes:

Crêpes with chocolate chips

Chocolate protein pancakes

apple pancakes

green pancakes on a plate

Easy vegan matcha matcha pancake recipe

Gaby Dimova

Delicious and easy to make vegan pancakes.

Preparation time 10 minutes min

Cook time 10 minutes min

Total time 20 minutes min

Course Breakfast

Kitchen Japanese

Portions 2 people

Calories 372 kcal

Equipment

  • stove

  • large bowl

  • Mix the spoon

Ingredients

  • 1 cup flour⁣
  • 1 tablespoon pulp
  • 1 tablespoon Sugar⁣
  • 1 tablespoon matcha powder
  • 1 cup milk without dairy products⁣
  • 1 tablespoon coconut oil
  • 1 teaspoon vanilla

Instructions

  • Combine all the ingredients in a large bowl and mix them well.

  • Grease your pan and add about ¼ cup of dough to the pan for each pancake.

  • Cook for a few minutes on each side, then return and do the same on the other.

  • When all your pancakes have cooked, stack them and garnish with cocoot or yogurt and maple syrup and berries.

  • I also added pumpkin and chia seeds to mine.

Video

https://www.youtube.com/watch?

Nutrition

Calories: 372kcalCarbohydrates: 55gProtein: 15gFat: 11gSaturated fats: 7gPolyunsaturated fat: 2gMonounsaturated fat: 1gSodium: 696MGPotassium: 388MGFiber: 7gSugar: 9gVitamin A: 844IUVitamin C: 8MGCalcium: 538MGIron: 5MG

BreakFast easymatchapancakesrecipesveganvegetarianworld

Navigation de l’article

Previous post
Next post

Related Posts

BreakFast

Easy recipe for homemade ginger

avril 27, 2025

Posted: October 22, 2023 Modified: October 22, 2023 by Gaby Dimova This message may contain affiliation links 11 Comments Jump Energize your day with the vibrant, spicy and invigorating flavor of Ginger blows. Ginger and turmeric are two of the most powerful supervision of nature with many advantages of immuno-construction,…

Read More
BreakFast

Vegetable chocolate protein balls – Revenues from the vegetarian world

avril 27, 2025

Jump If you need a healthy snack for work, ready to train, to pack a road trip or simply because you are hungry, you are in the right place. These healthy vegetable chocolate protein balls are filled, full of nutritious ingredients, and of course delicious! What you will need For…

Read More
BreakFast

Raspberry oat bars (vegan gluten -free)

avril 28, 2025

Posted: February 11, 2022 Modified: February 10, 2022 by Gaby Dimova This message may contain affiliation links 12 comments Jump These raspberry oat bars are vegans, gluten -free, made of nutritious ingredients, and they are my favorite fruity dessert! I have been doing them for years, and they have been…

Read More

Recent Posts

  • Frozen Yogurt Fruit Cups – Vegan and Gluten Free
  • Chia and Pumpkin Pudding – Recipes from the Vegetarian World
  • Chia and pistachio pudding – Recipes from the vegetarian world
  • Pumpkin Cinnamon Roll Up Pancakes – Veggie World Recipes
  • Blueberry Matcha – Recipes from the vegetarian world

Recent Comments

Aucun commentaire à afficher.

Archives

  • juillet 2026
  • mars 2026
  • octobre 2025
  • avril 2025
  • mars 2025
  • février 2025
  • janvier 2025
  • décembre 2024
  • novembre 2024
  • octobre 2024

Categories

  • All Recipes
  • Appetizers & Snacks
  • Baking & Desserts
  • BreakFast
  • Breakfast & Smoothies
  • Dressings & Sauces
  • Favorites
  • Main Dishes
  • Recipes By Features
  • Vegetarian & Vegan
  • Privacy Policy
  • Terms of Use
  • About verdictbakery
©2026 verdictbakery | WordPress Theme by SuperbThemes